PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C01181.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB_related
Protein Properties Length: 1743aa    MW: 187872 Da    PI: 6.4547
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C01181.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding301.2e-09834876347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE e++ +  +++G++ +++I++ +  ++t  +c+++++k+
   Pahal.C01181.1 834 PWTQEEKEIFMEMLAKFGKD-FSKISSFLM-HKTTADCVEFYYKH 876
                      8*****************99.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF819956.54E-5293378No hitNo description
SuperFamilySSF466892.09E-14819879IPR009057Homeodomain-like
PROSITE profilePS5129315.477830881IPR017884SANT domain
SMARTSM007171.8E-9831879IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-7832878IPR009057Homeodomain-like
PfamPF002491.7E-7833876IPR001005SANT/Myb domain
PROSITE profilePS5129312.610401091IPR017884SANT domain
SMARTSM007174.5E-610411089IPR001005SANT/Myb domain
SuperFamilySSF466891.09E-810441091IPR009057Homeodomain-like
CDDcd001671.95E-410451083No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1743 aa     Download sequence    Send to blast
MPPPPPDRRD YLYREGRRHD GGGGGDPLLP PAPTPPRWRD SPYHPPPPPP LRDHARPSPR  60
RAPPSASSEG YYRQAGGAYD RSYPDEPPLG YTPSRSDRYW TEDDGGGYKG FGRYGGGGGR  120
RDGRDIRGSY RRSPFRGYGS DFSRNHPEQP PPPPPRRSPL RSVAVPICYD PPGNRVDKGD  180
RDNLPRVTPW RRRESRSEVA DAAGAGPVSV GQTTRSAPSE KEASAQPPAG AAPHGADEEA  240
PRKKARLGWG QGLAKYEKQK VQGPADLAEA VADGSPADSE QKAAFPVPPP PPEPPAAPAP  300
LPEPPAAPAP PPEPPAAPAP PPPPAPPAAP APPATPAPEP LAPVQPAAPV PAAVYVPAPV  360
SAPSPARCPS PVDAPSSAAP FCTSAPEDKS YEQMAHMAIH PTKDVPEAGD KTFNTEFSIK  420
FDQLGSDPIN SLANMLADLL QHDDSCSGDS KGPTNASKLL LLKESISKEI EKTELEIDLL  480
EGELKSVSTK AGTAVEGSPT GVTYAEILSP SSGTSKVPVC VEISETSHVM KEPVELISSP  540
KPPVVQDANA KGSDMMEIEN APVRNAKTVS SEESAVSPVV AEGPACAAAD LSPLKASEGA  600
GSQIDMDNDR LETSPCHDNA DSIKTEVSDD PPVRQCSHHD HKYSLTSANN NIAKVTNESL  660
FKLLPADTLC LDLLASSHLL SQRKNDHHIK ERLGVCKNRL RLKEQILTLK FKAYRHLWKE  720
DLRLLSAKKQ RSKSNKRIDQ SNRASHIGSQ RQRSSNRSRL AMPAGNLSTF STPEMSDVAS  780
KLFSEFQIKR CRNYLKMPAL IIDEREKECL RFVSKNSLVD DPVLVEKERV MINPWTQEEK  840
EIFMEMLAKF GKDFSKISSF LMHKTTADCV EFYYKHHKSD SFREVKKLLD LRQQQPTGNF  900
LGAKSGKKWN PEANAASLDM LGVASVVAAH GLEYANRVEK VSAKSLIRTA YGSSISFAAK  960
KSSDREGIDS VPLNERESVA ADVLAGICGT LSPEGMGSCI TSSADLGQKI GMTRMEHILA  1020
SEFDRSIDEE DTLSDQECEV DPVDWNDDEK SIFIEAMNNY GKDFARISSC VKSKSYEQCK  1080
VFFSKARKSL GLDLIHRGAA DVSMPTSDTN GGRSDTDEAC AAEMDSAICS TQSCSKIEMD  1140
VCPTEKGIGG IITKQPELNP SNGFDAVNGK TGEDEKKADK NCGIVDHERF DEGTHQAACG  1200
PIDINCPEST EKLHGKDDAV DQVNMHNNSA ISSSTDQAMA VQSEVGSCLH SIEVLHQTSK  1260
APSGSGTDAS GMEECSNHAL DNKLLKAGNS GASSCIASDT CDNVQFANMT GASTISPTFA  1320
SSYKHSVPAD MAPTKPKPLV APLTPKDLMP VQFSSAVPDP TVIRFDGIAS ITMPNFEDSG  1380
SRVSSALGPK DMSKYPAFKD PTGNQHDTLF RNVDGFTNHL TTELPIFSER TASGTASTSQ  1440
TDRFTLTKFQ NGKSSSLGLP NTSDGIQWAR KHEEVLQGSL RSCSQNTSSE GDEQQKRPGD  1500
VKLFGKILNH QSYLQSSVPS CNGNKSKPPS PKVDMSSVRL SNNPRDRVVC SSRPGVTHLG  1560
LEERTARSYG HLDVSTTQPE PLLMMAKCQS LAGVPFYSAK NGAVGVFSDY QQPSIQPHQS  1620
DPKRLERFSD PQKRNGMELI SGFQQPGKIS RFGGAGILVS GVSDPVAALK AQYGPSSKVM  1680
GNDVDPWKDI GSSSIPFASL TCQQWHSAVG SLEVCPQADY ICLSGRVLFC QFMQRPHIIV  1740
IW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D3e-14792883494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C3e-14792883494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1727733KKQRSKS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960366.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
RefseqXP_012700232.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
RefseqXP_004960367.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
TrEMBLK3Z3350.0K3Z335_SETIT; Uncharacterized protein
STRINGSi020953m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.12e-83MYB family protein